PDB entry 2mwx

View 2mwx on RCSB PDB site
Description: The RING Domain of human Promyelocytic Leukemia Protein (PML)
Class: ligase
Keywords: PML, RING finger, TRIM19, E3 ligase, LIGASE
Deposited on 2014-12-02, released 2015-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mwxa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mwxA (A:)
eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal