Lineage for d2mwxa_ (2mwx A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037530Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 3037531Protein Acute promyelocytic leukaemia proto-oncoprotein PML [57858] (1 species)
  7. 3037532Species Human (Homo sapiens) [TaxId:9606] [57859] (2 PDB entries)
  8. 3037533Domain d2mwxa_: 2mwx A: [304212]
    automated match to d1bora_
    complexed with zn

Details for d2mwxa_

PDB Entry: 2mwx (more details)

PDB Description: the ring domain of human promyelocytic leukemia protein (pml)
PDB Compounds: (A:) Protein PML

SCOPe Domain Sequences for d2mwxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mwxa_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}
eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal

SCOPe Domain Coordinates for d2mwxa_:

Click to download the PDB-style file with coordinates for d2mwxa_.
(The format of our PDB-style files is described here.)

Timeline for d2mwxa_: