| Class g: Small proteins [56992] (100 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
| Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
| Protein Acute promyelocytic leukaemia proto-oncoprotein PML [57858] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57859] (2 PDB entries) |
| Domain d2mwxa_: 2mwx A: [304212] automated match to d1bora_ complexed with zn |
PDB Entry: 2mwx (more details)
SCOPe Domain Sequences for d2mwxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mwxa_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}
eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal
Timeline for d2mwxa_: