PDB entry 2ms4

View 2ms4 on RCSB PDB site
Description: Cyclophilin a complexed with a fragment of crk-ii
Class: isomerase
Keywords: cyclophilin a, isomerase
Deposited on 2014-07-22, released 2015-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ms4a_
  • Chain 'B':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2MS4 (0-8)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ms4A (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

  • Chain 'B':
    No sequence available.