PDB entry 2mf6

View 2mf6 on RCSB PDB site
Description: Solution NMR structure of Chimeric Avidin, ChiAVD(I117Y), in the biotin bound form
Class: biotin binding protein
Keywords: biotin binding protein
Deposited on 2013-10-07, released 2014-08-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVD, AVR4, AVR5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (3-39)
      • expression tag (0-2)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-128)
      • engineered mutation (117)
    Domains in SCOPe 2.05: d2mf6a_
  • Chain 'B':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVD, AVR4, AVR5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (3-39)
      • expression tag (0-2)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-128)
      • engineered mutation (117)
    Domains in SCOPe 2.05: d2mf6b_
  • Chain 'C':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVD, AVR4, AVR5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (3-39)
      • expression tag (0-2)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-128)
      • engineered mutation (117)
    Domains in SCOPe 2.05: d2mf6c_
  • Chain 'D':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVD, AVR4, AVR5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (3-39)
      • expression tag (0-2)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-128)
      • engineered mutation (117)
    Domains in SCOPe 2.05: d2mf6d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mf6A (A:)
qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
ftrlrtqke

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mf6B (B:)
qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
ftrlrtqke

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mf6C (C:)
qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
ftrlrtqke

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mf6D (D:)
qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
ftrlrtqke