SCOPe 2.05: Domain d2mf6d_: 2mf6 D:

Lineage for d2mf6d_ (2mf6 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (25 PDB entries)

8. Domain d2mf6d_: 2mf6 D: [262220]
   automated match to d2mf6a_

Details for d2mf6d_

PDB Entry: 2mf6

PDB Description: Solution NMR structure of Chimeric Avidin, ChiAVD(I117Y), in the biotin bound form

PDB Compounds: (D:) Avidin, Avidin-related protein 4/5

SCOPe Domain Sequences for d2mf6d_:

Sequence; same for both SEQRES and ATOM records:

>d2mf6d_ b.61.1.1 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
ftrlrtqke

Timeline for d2mf6d_:

• d2mf6d_ is new in SCOPe 2.05-stable
  
• d2mf6d_ is called d2mf6d1 in SCOPe 2.06
  
• d2mf6d_ appears in the current release, SCOPe 2.08, called d2mf6d1