PDB entry 2md7

View 2md7 on RCSB PDB site
Description: NMR structure of human Sp140 PHD finger trans conformer
Class: transcription
Keywords: PHD finger, TRANSCRIPTION
Deposited on 2013-09-02, released 2013-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Nuclear body protein SP140
  Species: Homo sapiens [TaxId:9606]
  Gene: SP140, LYSP100
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13342 (4-55)
    • expression tag (0-3)
  Domains in SCOPe 2.08: d2md7b1, d2md7b2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2md7B (B:)
  gamgmrnldecevcrdggelfccdtcsrvfhedchippveaertpwncifcrmkes