SCOPe 2.08: Domain d2md7b1: 2md7 B:5-56

Lineage for d2md7b1 (2md7 B:5-56)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d2md7b1: 2md7 B:5-56 [243176]
   Other proteins in same PDB: d2md7b2
   automated match to d1mm2a_
   complexed with zn

Details for d2md7b1

PDB Entry: 2md7

PDB Description: NMR structure of human Sp140 PHD finger trans conformer

PDB Compounds: (B:) Nuclear body protein SP140

SCOPe Domain Sequences for d2md7b1:

Sequence; same for both SEQRES and ATOM records:

>d2md7b1 g.50.1.0 (B:5-56) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrnldecevcrdggelfccdtcsrvfhedchippveaertpwncifcrmkes

Timeline for d2md7b1:

• d2md7b1 first appeared in SCOPe 2.04, called d2md7b_
  
• d2md7b1 appears in SCOPe 2.07