![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
![]() | Protein automated matches [190772] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries) |
![]() | Domain d2md7b1: 2md7 B:5-56 [243176] Other proteins in same PDB: d2md7b2 automated match to d1mm2a_ complexed with zn |
PDB Entry: 2md7 (more details)
SCOPe Domain Sequences for d2md7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2md7b1 g.50.1.0 (B:5-56) automated matches {Human (Homo sapiens) [TaxId: 9606]} mrnldecevcrdggelfccdtcsrvfhedchippveaertpwncifcrmkes
Timeline for d2md7b1: