PDB entry 2mb7

View 2mb7 on RCSB PDB site
Description: Solution structure of MBD3 methylcytosine binding domain
Class: transcription
Keywords: MBD3, DNA methylation, NuRD, chromatin, TRANSCRIPTION
Deposited on 2013-07-26, released 2013-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyl-CpG-binding domain protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MBD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95983 (2-71)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d2mb7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mb7A (A:)
gsmerkrwecpalpqgwereevprrsglsaghrdvfyyspsgkkfrskpqlarylggsmd
lstfdfrtgkml