SCOPe 2.05: Domain d2mb7a_: 2mb7 A:

Lineage for d2mb7a_ (2mb7 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (5 families)

5. Family d.10.1.0: automated matches [254255] (1 protein)
   not a true family

6. Protein automated matches [254589] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255497] (2 PDB entries)

8. Domain d2mb7a_: 2mb7 A: [243159]
   automated match to d1ig4a_

Details for d2mb7a_

PDB Entry: 2mb7

PDB Description: Solution structure of MBD3 methylcytosine binding domain

PDB Compounds: (A:) Methyl-CpG-binding domain protein 3

SCOPe Domain Sequences for d2mb7a_:

Sequence; same for both SEQRES and ATOM records:

>d2mb7a_ d.10.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmerkrwecpalpqgwereevprrsglsaghrdvfyyspsgkkfrskpqlarylggsmd
lstfdfrtgkml

Timeline for d2mb7a_:

• d2mb7a_ first appeared in SCOPe 2.04
  
• d2mb7a_ is called d2mb7a1 in SCOPe 2.06
  
• d2mb7a_ appears in the current release, SCOPe 2.08, called d2mb7a1