PDB entry 2ma1

View 2ma1 on RCSB PDB site
Description: Solution structure of HRDC1 domain of RecQ helicase from Deinococcus radiodurans
Class: DNA binding protein
Keywords: DNA BINDING PROTEIN, RecQ HRDC domain 1
Deposited on 2013-06-24, released 2013-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA helicase RecQ
  Species: Deinococcus radiodurans [TaxId:243230]
  Gene: DrRecQ, DR_1289
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9RUU2 (0-74)
  Domains in SCOPe 2.06: d2ma1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ma1A (A:)
  hdaplfealrawrlqkakelslppytifhdatlktiaelrpgshatlgtvsgvggrklaa
  ygdevlqvvrdssgg