PDB entry 2m8p

View 2m8p on RCSB PDB site
Description: The structure of the W184AM185A mutant of the HIV-1 capsid protein
Class: viral protein
Keywords: capsid, HIV, mutant, VIRAL PROTEIN
Deposited on 2013-05-24, released 2013-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-220)
      • engineered mutation (183-184)
    Domains in SCOPe 2.06: d2m8pa1, d2m8pa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m8pA (A:)
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
vknaatetllvqnanpdcktilkalgpgatleemmtacqgv