PDB entry 2m66

View 2m66 on RCSB PDB site
Description: Endoplasmic reticulum protein 29 (ERp29) C-terminal domain: 3D Protein Fold Determination from Backbone Amide Pseudocontact Shifts Generated by Lanthanide Tags at Multiple Sites
Class: chaperone
Keywords: ERp29, Erp29-C, Chaperone, GPS-Rosetta
Deposited on 2013-03-26, released 2013-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum resident protein 29
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Erp29
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2m66a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m66A (A:)
pgclpaydalagqfieassrearqailkqgqdglsgvketdkkwasqylkimgkildqge
dfpaselarisklienkmsegkkeelqrslniltafrkkgaekeel