PDB entry 2m3l

View 2m3l on RCSB PDB site
Description: Solution structure of the C-terminal zinc-binding domain of HPV51 oncoprotein E6
Class: oncoprotein
Keywords: Papillomavirus E6 Proteins, HPV, Oncoprotein E6, Zinc Fingers, E6, Viral, Oncogene Proteins, ONCOPROTEIN
Deposited on 2013-01-21, released 2013-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein E6
    Species: Human papillomavirus type 51 [TaxId:10595]
    Gene: E6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26554 (4-75)
      • expression tag (0-3)
    Domains in SCOPe 2.05: d2m3la_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m3lA (A:)
gshmsrsvygttleaitkkslydlsirchrcqrplgpeekqklvdekkrfheiagrwtgq
cancwqrtrqrnetqv