Class g: Small proteins [56992] (92 folds) |
Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily) alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro protein |
Superfamily g.90.1: E6 C-terminal domain-like [161229] (1 family) automatically mapped to Pfam PF00518 |
Family g.90.1.1: E6 C-terminal domain-like [161230] (2 proteins) C-terminal part of Pfam PF00518 |
Protein automated matches [254600] (2 species) not a true protein |
Species Human papillomavirus type 51 [TaxId:10595] [255477] (1 PDB entry) |
Domain d2m3la_: 2m3l A: [243091] automated match to d2fk4a1 complexed with zn |
PDB Entry: 2m3l (more details)
SCOPe Domain Sequences for d2m3la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m3la_ g.90.1.1 (A:) automated matches {Human papillomavirus type 51 [TaxId: 10595]} gshmsrsvygttleaitkkslydlsirchrcqrplgpeekqklvdekkrfheiagrwtgq cancwqrtrqrnetqv
Timeline for d2m3la_: