PDB entry 2m2d

View 2m2d on RCSB PDB site
Description: Human programmed cell death 1 receptor
Class: apoptosis
Keywords: pd-1, apoptosis
Deposited on 2012-12-18, released 2013-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Pdcd1, Pd1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15116 (1-117)
      • expression tag (0)
      • conflict (60)
    Domains in SCOPe 2.07: d2m2da1, d2m2da2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m2dA (A:)
    mpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
    srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvterrae