PDB entry 2m14

View 2m14 on RCSB PDB site
Description: NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and Rad4
Class: transcription/DNA binding protein
Keywords: Tfb1, PH domain, TRANSCRIPTION-DNA BINDING PROTEIN complex
Deposited on 2012-11-16, released 2013-01-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: TFB1, YDR311W, D9740.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (1-114)
      • expression tag (0)
    Domains in SCOPe 2.04: d2m14a_
  • Chain 'B':
    Compound: DNA repair protein RAD4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: RAD4, YER162C
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2m14A (A:)
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdadgnss

    Sequence, based on observed residues (ATOM records): (download) 
    >2m14A (A:)
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

  • Chain 'B':
    No sequence available.