PDB entry 2m10

View 2m10 on RCSB PDB site
Description: trans form of a photoswitchable PDZ domain crosslinked with an azobenzene derivative
Class: hydrolase
Keywords: photoswitch, HYDROLASE
Deposited on 2012-11-09, released 2013-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 13
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN13, PNP1, PTP1E, PTPL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12923 (1-96)
      • expression tag (0)
      • engineered mutation (21)
      • engineered mutation (76)
    Domains in SCOPe 2.07: d2m10a1, d2m10a2
  • Heterogens: 33B

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m10A (A:)
gpkpgdifevelakndnslgicvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvl
avngvslegathkqavctlrntgqvvhlllekgqspt