PDB entry 2m0x

View 2m0x on RCSB PDB site
Description: Solution structure of U14Ub1, an engineered ubiquitin variant with increased affinity for USP14
Class: de novo protein
Keywords: de novo protein
Deposited on 2012-11-08, released 2013-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: engineered ubiquitin variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2M0X (0-75)
    Domains in SCOPe 2.06: d2m0xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m0xA (A:)
    mqifvkgltgktttlevepsdtienvkakiqdktglppdqqrlifagkqledgrtlsdyn
    iqkestlhivwrlrgg