PDB entry 2lrk
View 2lrk on RCSB PDB site
Description: Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose
Class: transferase
Keywords: protein-protein complex, TRANSFERASE
Deposited on
2012-04-06, released
2012-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-07-25, with a file datestamp of
2012-07-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
Species: Escherichia coli [TaxId:83333]
Gene: chbA, celC, b1736, JW1725
Database cross-references and differences (RAF-indexed):
- Uniprot P69791 (0-102)
- engineered mutation (75)
- engineered mutation (78)
Domains in SCOPe 2.06: d2lrka_ - Chain 'B':
Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
Species: Escherichia coli [TaxId:83333]
Gene: chbA, celC, b1736, JW1725
Database cross-references and differences (RAF-indexed):
- Uniprot P69791 (0-102)
- engineered mutation (75)
- engineered mutation (78)
Domains in SCOPe 2.06: d2lrkb_ - Chain 'C':
Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
Species: Escherichia coli [TaxId:83333]
Gene: chbA, celC, b1736, JW1725
Database cross-references and differences (RAF-indexed):
- Uniprot P69791 (0-102)
- engineered mutation (75)
- engineered mutation (78)
Domains in SCOPe 2.06: d2lrkc_ - Chain 'D':
Compound: Phosphocarrier protein HPr
Species: Escherichia coli [TaxId:83333]
Gene: ptsH, hpr, b2415, JW2408
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2lrkd_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2lrkA (A:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2lrkB (B:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2lrkC (C:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2lrkD (D:)
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele