PDB entry 2lls

View 2lls on RCSB PDB site
Description: solution structure of human apo-S100A1 C85M
Class: metal binding protein
Keywords: S100 protein family, calcium binding protein, METAL BINDING PROTEIN
Deposited on 2011-11-17, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23297 (0-92)
      • engineered mutation (84)
    Domains in SCOPe 2.07: d2llsa_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23297 (0-92)
      • engineered mutation (84)
    Domains in SCOPe 2.07: d2llsb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2llsA (A:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvamnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2llsB (B:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvamnnffwens