PDB entry 2lls
View 2lls on RCSB PDB site
Description: solution structure of human apo-S100A1 C85M
Class: metal binding protein
Keywords: S100 protein family, calcium binding protein, METAL BINDING PROTEIN
Deposited on
2011-11-17, released
2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated
2012-12-19, with a file datestamp of
2012-12-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protein S100-A1
Species: Homo sapiens [TaxId:9606]
Gene: S100A1, S100A
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2llsa_ - Chain 'B':
Compound: Protein S100-A1
Species: Homo sapiens [TaxId:9606]
Gene: S100A1, S100A
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2llsb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2llsA (A:)
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
ldengdgevdfqeyvvlvaaltvamnnffwens
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2llsB (B:)
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
ldengdgevdfqeyvvlvaaltvamnnffwens