PDB entry 2le1

View 2le1 on RCSB PDB site
Description: Solution NMR Structure of Tfu_2981 from Thermobifida fusca, Northeast Structural Genomics Consortium Target TfR85A
Class: structural genomics, unknown function
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, UNKNOWN FUNCTION
Deposited on 2011-06-03, released 2011-06-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Thermobifida fusca [TaxId:269800]
    Gene: Tfu_2981
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47KK8 (0-142)
      • expression tag (143-150)
    Domains in SCOPe 2.05: d2le1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2le1A (A:)
    matlrrsvevaapaadvwtlvgdfsaihrwhpqvsaptlrgasphtpgaervfgagteee
    lverlverdesarrlvytmpdppfpitnhravlevvprddrhctvvwtamfdcspetare
    lesvigdgvfavglnalaerygrlehhhhhh