Lineage for d2le1a_ (2le1 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926677Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1926678Protein automated matches [190218] (20 species)
    not a true protein
  7. 1926837Species Thermobifida fusca [TaxId:269800] [255430] (1 PDB entry)
  8. 1926838Domain d2le1a_: 2le1 A: [242852]
    automated match to d3cnwa1

Details for d2le1a_

PDB Entry: 2le1 (more details)

PDB Description: Solution NMR Structure of Tfu_2981 from Thermobifida fusca, Northeast Structural Genomics Consortium Target TfR85A
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2le1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2le1a_ d.129.3.0 (A:) automated matches {Thermobifida fusca [TaxId: 269800]}
matlrrsvevaapaadvwtlvgdfsaihrwhpqvsaptlrgasphtpgaervfgagteee
lverlverdesarrlvytmpdppfpitnhravlevvprddrhctvvwtamfdcspetare
lesvigdgvfavglnalaerygrlehhhhhh

SCOPe Domain Coordinates for d2le1a_:

Click to download the PDB-style file with coordinates for d2le1a_.
(The format of our PDB-style files is described here.)

Timeline for d2le1a_: