![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (20 species) not a true protein |
![]() | Species Thermobifida fusca [TaxId:269800] [255430] (1 PDB entry) |
![]() | Domain d2le1a_: 2le1 A: [242852] automated match to d3cnwa1 |
PDB Entry: 2le1 (more details)
SCOPe Domain Sequences for d2le1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2le1a_ d.129.3.0 (A:) automated matches {Thermobifida fusca [TaxId: 269800]} matlrrsvevaapaadvwtlvgdfsaihrwhpqvsaptlrgasphtpgaervfgagteee lverlverdesarrlvytmpdppfpitnhravlevvprddrhctvvwtamfdcspetare lesvigdgvfavglnalaerygrlehhhhhh
Timeline for d2le1a_: