PDB entry 2lbn

View 2lbn on RCSB PDB site
Description: (Revised) Solution structure of the monomeric form of a mutant unliganded bovine neurophysin, 20 structures
Class: Peptide binding protein, hormone
Keywords: Dimerization, Hormone, Peptide binding protein
Deposited on 2011-04-01, released 2012-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neurophysin 1
  Species: Bos taurus [TaxId:9913]
  Gene: OXT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01175 (0-91)
    • engineered mutation (79)
  Domains in SCOPe 2.07: d2lbna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lbnA (A:)
  avldldvrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
  cgsggrcaaagiccspdgceedpacdpeaafs