PDB entry 2l8n

View 2l8n on RCSB PDB site
Description: NMR structure of the cytidine repressor DNA binding domain in presence of operator half-site DNA
Class: transcription regulator
Keywords: bacterial gene repressor, helix turn helix binding domain, lacr family, repressor, transcription, transcription regulation, DNA binding protein, transcription regulator
Deposited on 2011-01-20, released 2011-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor CytR
    Species: Escherichia coli [TaxId:362663]
    Gene: B3934, CYTR, ECP_4143, JW3905
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2l8na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2l8nA (A:)
mkakkqetaatmkdvalkakvstatvsralmnpdkvsqatrnrvekaarevgylpqpmgr
nvkrnes

    Sequence, based on observed residues (ATOM records): (download) 
    >2l8nA (A:)
aatmkdvalkakvstatvsralmnpdkvsqatrnrvekaarevgylp