PDB entry 2l4t

View 2l4t on RCSB PDB site
Description: GIP/Glutaminase L peptide complex
Class: protein binding
Keywords: GIP, Glutaminase L, PDZ domain, PROTEIN BINDING
Deposited on 2010-10-13, released 2011-04-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2l4ta_
  • Chain 'B':
    Compound: Glutaminase L peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2L4T (0-7)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l4tA (A:)
msyipgqpvtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrv
seggpaeiaglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqq
smls

  • Chain 'B':
    No sequence available.