PDB entry 2l39

View 2l39 on RCSB PDB site
Description: Mouse prion protein fragment 121-231 AT 37 C
Class: membrane protein
Keywords: prion, conformational exchange, MEMBRANE PROTEIN
Deposited on 2010-09-10, released 2011-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Mus musculus [TaxId:10090]
  Gene: Prnp, RP23-401J24.1-001
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q4FJQ7 (2-113)
    • see remark 999 (0-1)
  Domains in SCOPe 2.06: d2l39a1, d2l39a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l39A (A:)
  gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
  cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss