PDB entry 2l29

View 2l29 on RCSB PDB site
Description: Complex structure of E4 mutant human IGF2R domain 11 bound to IGF-II
Class: transport protein
Keywords: mannose 6 phosphate receptor, Insulin-like growth factor 2, Genomic imprinting, ligand trap, TRANSPORT PROTEIN
Deposited on 2010-08-13, released 2012-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Insulin-like growth factor 2 receptor variant
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q59EZ3 (0-139)
    • engineered mutation (36-37)
    • engineered mutation (39)
    • expression tag (140-141)
  Domains in SCOPe 2.06: d2l29a1, d2l29a2
• Chain 'B':
  Compound: insulin-like growth factor II
  Species: Homo sapiens [TaxId:9606]
  Gene: IGF2, PP1446
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01344 (0-66)
  Domains in SCOPe 2.06: d2l29b_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l29A (A:)
  mksnehddcqvtnpstghlfdlsslsgragftaaysksgvvymsicgenencppgvgacf
  gqtrisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmli
  sldkqtctlffswhtplacepe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l29B (B:)
  ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
  atpakse