PDB entry 2l1k

View 2l1k on RCSB PDB site
Description: Mouse prion protein (121-231) containing the substitutions Y169A, Y225A, and Y226A
Class: membrane protein
Keywords: prion, mutation, MEMBRANE PROTEIN
Deposited on 2010-07-28, released 2011-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, RP23-401J24.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4FJQ7 (2-113)
      • expression tag (0-1)
      • engineered mutation (50)
      • engineered mutation (106-107)
    Domains in SCOPe 2.06: d2l1ka1, d2l1ka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l1kA (A:)
gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqasnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqaaadgrrss