PDB entry 2kyf

View 2kyf on RCSB PDB site
Description: solution structure of calcium-bound CPV3
Class: calcium binding protein
Keywords: EF-hand protein, parvalbumin, calcium binding protein
Deposited on 2010-05-25, released 2011-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Parvalbumin, thymic CPV3
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43305 (0-107)
    • engineered mutation (71)
  Domains in SCOPe 2.08: d2kyfa_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kyfA (A:)
  sltdilspsdiaaalrdcqapdsfspkkffqisgmskksssqlkeifrildndqsgfiee
  delkyflqrfesgarvltasetktflaaadhdgdgkigaeefqemvqs