Lineage for d2kyfa_ (2kyf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710476Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 2710537Protein automated matches [254433] (3 species)
    not a true protein
  7. 2710538Species Chicken (Gallus gallus) [TaxId:9031] [255387] (2 PDB entries)
  8. 2710539Domain d2kyfa_: 2kyf A: [242697]
    automated match to d1rroa_
    complexed with ca

Details for d2kyfa_

PDB Entry: 2kyf (more details)

PDB Description: solution structure of calcium-bound cpv3
PDB Compounds: (A:) Parvalbumin, thymic CPV3

SCOPe Domain Sequences for d2kyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kyfa_ a.39.1.4 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sltdilspsdiaaalrdcqapdsfspkkffqisgmskksssqlkeifrildndqsgfiee
delkyflqrfesgarvltasetktflaaadhdgdgkigaeefqemvqs

SCOPe Domain Coordinates for d2kyfa_:

Click to download the PDB-style file with coordinates for d2kyfa_.
(The format of our PDB-style files is described here.)

Timeline for d2kyfa_: