PDB entry 2ku6

View 2ku6 on RCSB PDB site
Description: Mouse Prion Protein (121-231) with mutations D167S and N173K
Class: unknown function
Keywords: mPrP_D167S_N173K, mouse, prion protein, mutant, Amyloid, Cell membrane, Disulfide bond, Glycoprotein, Golgi apparatus, GPI-anchor, Hydroxylation, Lipoprotein, Membrane, Prion, UNKNOWN FUNCTION
Deposited on 2010-02-12, released 2010-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, Prn-p, Prp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04925 (1-112)
      • expression tag (0)
      • engineered (47)
      • engineered (53)
    Domains in SCOPe 2.06: d2ku6a1, d2ku6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ku6A (A:)
svvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvsqysnqknfvhdc
vnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss