PDB entry 2ku4

View 2ku4 on RCSB PDB site
Description: Horse prion protein
Class: membrane protein
Keywords: ecPrP, prion, horse, equus caballus, Amyloid, Cell membrane, Membrane, MEMBRANE PROTEIN
Deposited on 2010-02-12, released 2010-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Equus caballus [TaxId:9796]
    Gene: PrP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97964 (2-112)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2ku4a1, d2ku4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ku4A (A:)
    gsvvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvseysnqknfvhd
    cvnitvkqhtvttttkgenftetdvkimervveqmcitqyqkeyeafqqrgas