PDB entry 2kod

View 2kod on RCSB PDB site
Description: A high-resolution NMR structure of the dimeric C-terminal domain of HIV-1 CA
Class: viral protein
Keywords: HIV-1 capsid, C-terminal domain, VIRAL PROTEIN
Deposited on 2009-09-18, released 2009-11-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HIV-1 CA C-terminal domain
  Species: HIV-1 M:B_HXB2R [TaxId:11706]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-87)
  Domains in SCOPe 2.04: d2koda_
• Chain 'B':
  Compound: HIV-1 CA C-terminal domain
  Species: HIV-1 M:B_HXB2R [TaxId:11706]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-87)
  Domains in SCOPe 2.04: d2kodb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kodA (A:)
  mysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilk
  algpaatleemmtacqgvggpghkarvl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kodB (B:)
  mysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilk
  algpaatleemmtacqgvggpghkarvl