PDB entry 2knm

View 2knm on RCSB PDB site
Description: Solution structure of the cyclotide cycloviolacin O2
Class: plant protein
Keywords: cyclotide, cyclic cystine knot, circular protein, Cytolysis, Disulfide bond, Hemolysis, Knottin, Plant defense, PLANT PROTEIN
Deposited on 2009-08-27, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cycloviolacin-O2
  Species: Viola odorata [TaxId:97441]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P58434 (0-29)
  Domains in SCOPe 2.07: d2knma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2knmA (A:)
  gipcgescvwipcissaigcsckskvcyrn