PDB entry 2kmb
View 2kmb on RCSB PDB site
Description: complex of 3'-neuac-lewis-x with a selectin-like mutant of mannose-binding protein a
Class: lectin
Keywords: lectin
Deposited on
1996-11-07, released
1997-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain '1':
Compound: mannose-binding protein-a
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2kmb11, d2kmb12 - Chain '2':
Compound: mannose-binding protein-a
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2kmb21, d2kmb22 - Chain '3':
Compound: mannose-binding protein-a
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2kmb31, d2kmb32 - Heterogens: CA, CL, HOH
PDB Chain Sequences:
- Chain '1':
Sequence; same for both SEQRES and ATOM records: (download)
>2kmb1 (1:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqkkktavcefpa
- Chain '2':
Sequence; same for both SEQRES and ATOM records: (download)
>2kmb2 (2:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqkkktavcefpa
- Chain '3':
Sequence; same for both SEQRES and ATOM records: (download)
>2kmb3 (3:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqkkktavcefpa