PDB entry 2kkz

View 2kkz on RCSB PDB site
Description: Solution NMR structure of the monomeric W187R mutant of A/Udorn NS1 effector domain. Northeast Structural Genomics target OR8C[W187R].
Class: antiviral protein
Keywords: Influenza A, Effector Domain, solution NMR structure, W187R mutant, Cytoplasm, Host-virus interaction, Interferon antiviral system evasion, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, ANTIVIRAL PROTEIN
Deposited on 2009-06-29, released 2009-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-structural protein NS1
  Species: Influenza A virus [TaxId:221021]
  Gene: NS, NS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6XSU2 (1-131)
    • initiating methionine (0)
    • engineered (103)
    • expression tag (132-133)
  Domains in SCOPe 2.06: d2kkza1, d2kkza2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2kkzA (A:)
  mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
  lillrafteegaivgeisplpsfpghtiedvknaigvligglerndntvrvsktlqrfaw
  gssnengrppltlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2kkzA (A:)
  mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
  lillrafteegaivgeisplpsfpghtiedvknaigvligglerndntvrvsktlqrfaw
  gssnengrppltle