PDB entry 2kgt

View 2kgt on RCSB PDB site
Description: Solution structure of SH3 domain of PTK6
Class: Transferase
Keywords: SH3 domain, Src kinase, PTK6, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, SH2 domain, Transferase, Tyrosine-protein kinase
Deposited on 2009-03-18, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase 6
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13882 (0-71)
  Domains in SCOPe 2.07: d2kgta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kgtA (A:)
  mvsrdqahlgpkyvglwdfksrtdeelsfragdvfhvarkeeqwwwatlldeaggavaqg
  yvphnylaeret