PDB entry 2kfx

View 2kfx on RCSB PDB site
Description: Structure of the N-terminal domain of human cardiac troponin C bound to calcium ion and to the inhibitor W7
Class: metal binding protein
Keywords: calcium regulation, striated muscle, cardiac, troponin, W7, cardiotonic drugs, Acetylation, Calcium, Cardiomyopathy, Disease mutation, Muscle protein, Polymorphism, METAL BINDING PROTEIN
Deposited on 2009-02-28, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1, TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-88)
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d2kfxt_
  • Heterogens: CA, WW7

PDB Chain Sequences:

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kfxT (T:)
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkdds