PDB entry 2kfo

View 2kfo on RCSB PDB site
Description: Mouse Prion Protein (121-231) with Mutation V166A
Class: unknown function
Keywords: Mouse Prion Protein, Mutation V166A, long-range effect, Cell membrane, Glycoprotein, Golgi apparatus, GPI-anchor, Hydroxylation, Lipoprotein, Membrane, Polymorphism, Prion, UNKNOWN FUNCTION
Deposited on 2009-02-24, released 2009-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prn-p, Prnp, Prp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04925 (2-113)
      • expression tag (0-1)
      • engineered (47)
    Domains in SCOPe 2.06: d2kfoa1, d2kfoa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kfoA (A:)
gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpadqysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss