PDB entry 2kfm

View 2kfm on RCSB PDB site
Description: Mouse Prion Protein (121-231) with Mutations Y225A and Y226A
Class: unknown function
Keywords: Mouse Prion Protein, Mutation Y225A,Y226A, long-range effect, Cell membrane, Glycoprotein, Golgi apparatus, GPI-anchor, Hydroxylation, Lipoprotein, Membrane, Polymorphism, Prion, MEMBRANE PROTEIN, UNKNOWN FUNCTION
Deposited on 2009-02-24, released 2009-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Mus musculus [TaxId:10090]
  Gene: Prnp, Prn-p, Prp
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04925 (2-113)
    • expression tag (1)
    • engineered (106-107)
  Domains in SCOPe 2.06: d2kfma1, d2kfma2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2kfmA (A:)
  gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
  cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqaaadgrrss
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2kfmA (A:)
  svvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdc
  vnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqaaadgrrss