PDB entry 2k7v

View 2k7v on RCSB PDB site
Description: Deletions in a surface loop divert the folding of a protein domain into a metastable dimeric form
Class: transferase
Keywords: Misfolded dimer, Acyltransferase, Glycolysis, Lipoyl, Transferase
Deposited on 2008-08-27, released 2009-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  Species: Escherichia coli [TaxId:83333]
  Gene: aceF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06959 (1-84)
    • expression tag (0)
  Domains in SCOPe 2.06: d2k7va1, d2k7va2
• Chain 'B':
  Compound: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  Species: Escherichia coli [TaxId:83333]
  Gene: aceF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06959 (1-84)
    • expression tag (0)
  Domains in SCOPe 2.06: d2k7vb1, d2k7vb2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k7vA (A:)
  mvkevnvpdivevtevmvkvgdkvaaeqslitvegdkasmevpapfagvvkelkvnvgdk
  vktgslimifevegaapaaapakqe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k7vB (B:)
  mvkevnvpdivevtevmvkvgdkvaaeqslitvegdkasmevpapfagvvkelkvnvgdk
  vktgslimifevegaapaaapakqe