PDB entry 2k78

View 2k78 on RCSB PDB site
Description: Solution Structure of the IsdC NEAT domain bound to Zinc Protoporphyrin
Class: heme-binding protein
Keywords: NEAT domain, NMR complex, heme, Isd, IsdC, Cell wall, Iron, Metal-binding, Peptidoglycan-anchor, Secreted, TRANSPORT PROTEIN, HEME-BINDING PROTEIN
Deposited on 2008-08-06, released 2008-08-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-regulated surface determinant protein C
    Species: Staphylococcus aureus (strain MW2) [TaxId:196620]
    Gene: isdC, sirD, MW1013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2k78a_
  • Heterogens: ZNH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2k78A (A:)
mgsshhhhhhssglvprgshmsanaadsgtlnyevykyntndtsiandyfnkpakyikkn
gklyvqitvnhshwitgmsieghkeniiskntakdertsefevsklngkidgkidvyide
kvngkpfkydhhynitykfngptdvag

    Sequence, based on observed residues (ATOM records): (download) 
    >2k78A (A:)
sanaadsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsie
ghkeniiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfng
ptdvag