Lineage for d2k78a_ (2k78 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771461Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1771462Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 1771485Protein automated matches [191246] (3 species)
    not a true protein
  7. 1771499Species Staphylococcus aureus [TaxId:196620] [255324] (2 PDB entries)
  8. 1771502Domain d2k78a_: 2k78 A: [242390]
    automated match to d2o6pa1
    complexed with znh

Details for d2k78a_

PDB Entry: 2k78 (more details)

PDB Description: solution structure of the isdc neat domain bound to zinc protoporphyrin
PDB Compounds: (A:) Iron-regulated surface determinant protein C

SCOPe Domain Sequences for d2k78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k78a_ b.1.28.1 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
sanaadsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsie
ghkeniiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfng
ptdvag

SCOPe Domain Coordinates for d2k78a_:

Click to download the PDB-style file with coordinates for d2k78a_.
(The format of our PDB-style files is described here.)

Timeline for d2k78a_: