Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) |
Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
Protein automated matches [191246] (3 species) not a true protein |
Species Staphylococcus aureus [TaxId:196620] [255324] (2 PDB entries) |
Domain d2k78a_: 2k78 A: [242390] automated match to d2o6pa1 complexed with znh |
PDB Entry: 2k78 (more details)
SCOPe Domain Sequences for d2k78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k78a_ b.1.28.1 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]} sanaadsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsie ghkeniiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfng ptdvag
Timeline for d2k78a_: