PDB entry 2k6x

View 2k6x on RCSB PDB site
Description: Autoregulation of a Group 1 Bacterial Sigma Factor Involves the Formation of a Region 1.1- Induced Compacted Structure
Class: transcription
Keywords: sigma 1.1, DNA-binding, Sigma factor, Transcription, Transcription regulation
Deposited on 2008-07-28, released 2008-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor rpoD
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rpoD, sigA, TM_1451
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77994 (4-71)
      • expression tag (0-3)
      • engineered (71)
    Domains in SCOPe 2.08: d2k6xa1, d2k6xa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k6xA (A:)
gshmpqierrikklislgkkkgyityedidkafppdfegfdtnlieriheelekhginiv
enepeeeeisag