Lineage for d2k6xa1 (2k6x A:29-96)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695870Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 2695878Protein Sigma70 (SigA, RpoD) [88666] (4 species)
    Pfam PF03979
  7. 2695884Species Thermotoga maritima [TaxId:2336] [116817] (2 PDB entries)
    Uniprot P77994 313-399
  8. 2695886Domain d2k6xa1: 2k6x A:29-96 [304150]
    Other proteins in same PDB: d2k6xa2

Details for d2k6xa1

PDB Entry: 2k6x (more details)

PDB Description: autoregulation of a group 1 bacterial sigma factor involves the formation of a region 1.1- induced compacted structure
PDB Compounds: (A:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2k6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k6xa1 a.4.13.2 (A:29-96) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]}
pqierrikklislgkkkgyityedidkafppdfegfdtnlieriheelekhginivenep
eeeeisag

SCOPe Domain Coordinates for d2k6xa1:

Click to download the PDB-style file with coordinates for d2k6xa1.
(The format of our PDB-style files is described here.)

Timeline for d2k6xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k6xa2