![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
![]() | Protein Sigma70 (SigA, RpoD) [88666] (4 species) Pfam PF03979 |
![]() | Species Thermotoga maritima [TaxId:2336] [116817] (2 PDB entries) Uniprot P77994 313-399 |
![]() | Domain d2k6xa1: 2k6x A:29-96 [304150] Other proteins in same PDB: d2k6xa2 |
PDB Entry: 2k6x (more details)
SCOPe Domain Sequences for d2k6xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k6xa1 a.4.13.2 (A:29-96) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]} pqierrikklislgkkkgyityedidkafppdfegfdtnlieriheelekhginivenep eeeeisag
Timeline for d2k6xa1: