SCOPe 2.08: Domain d2k6xa1: 2k6x A:29-96

Lineage for d2k6xa1 (2k6x A:29-96)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.2: Sigma4 domain [88665] (5 proteins)

6. Protein Sigma70 (SigA, RpoD) [88666] (4 species)
   Pfam PF03979

7. Species Thermotoga maritima [TaxId:2336] [116817] (2 PDB entries)
   Uniprot P77994 313-399

8. Domain d2k6xa1: 2k6x A:29-96 [304150]
   Other proteins in same PDB: d2k6xa2

Details for d2k6xa1

PDB Entry: 2k6x

PDB Description: autoregulation of a group 1 bacterial sigma factor involves the formation of a region 1.1- induced compacted structure

PDB Compounds: (A:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2k6xa1:

Sequence; same for both SEQRES and ATOM records:

>d2k6xa1 a.4.13.2 (A:29-96) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]}
pqierrikklislgkkkgyityedidkafppdfegfdtnlieriheelekhginivenep
eeeeisag

Timeline for d2k6xa1:

• d2k6xa1 first appeared in SCOPe 2.06
  
• d2k6xa1 appears in SCOPe 2.07