PDB entry 2k23

View 2k23 on RCSB PDB site
Description: Solution Structure Analysis of the rLcn2
Class: transport protein
Keywords: beta barrel, TRANSPORT PROTEIN
Deposited on 2008-03-21, released 2009-03-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipocalin 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Lcn2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2k23a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k23A (A:)
qdstqnlipapplisvplqpgfwterfqgrwfvvglagnavqkerqsrftmystiyelqe
dnsynvtsilvrgqgcrywirtfvpssrpgqftlgnihsypqiqsydvqvadtdydqfam
vffqktsenkqyfkvtlygrtkglsdelkerfvsfakslglkdnnivfsvptdqcidn