PDB entry 2k1z

View 2k1z on RCSB PDB site
Description: Solution structure of Par-3 PDZ3
Class: signaling protein
Keywords: Par-3, PDZ domain, Scaffold protein, Cell polarity, Alternative splicing, Cell cycle, Cell division, Cell junction, Coiled coil, Membrane, Phosphoprotein, Tight junction, SIGNALING PROTEIN
Deposited on 2008-03-18, released 2008-06-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Partitioning-defective 3 homolog
    Species: Rattus norvegicus
    Gene: Pard3, Par3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2k1za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2k1zA (A:)
gtrefltfevplndsgsaglgvsvkgnrskenhadlgifvksiinggaaskdgrlrvndq
liavngesllgkanqeametlrrsmstegnkrgmiqlivarris