PDB entry 2jz3
View 2jz3 on RCSB PDB site
Description: SOCS box elonginBC ternary complex
Class: transcription inhibitor/transcription
Keywords: socs proteins, elongins, cytokine signaling, Growth regulation, Phosphoprotein, SH2 domain, Signal transduction inhibitor, Ubl conjugation pathway, Nucleus, Transcription, Transcription regulation, signaling protein, TRANSCRIPTION INHIBITOR-TRANSCRIPTION COMPLEX
Deposited on
2007-12-27, released
2008-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-03-02, with a file datestamp of
2011-02-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Suppressor of cytokine signaling 3
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Transcription elongation factor B polypeptide 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2jz3b_ - Chain 'C':
Compound: Transcription elongation factor B polypeptide 1
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2jz3c_
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2jz3B (B:)
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2jz3C (C:)
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc