PDB entry 2jz3

View 2jz3 on RCSB PDB site
Description: SOCS box elonginBC ternary complex
Class: transcription inhibitor/transcription
Keywords: socs proteins, elongins, cytokine signaling, Growth regulation, Phosphoprotein, SH2 domain, Signal transduction inhibitor, Ubl conjugation pathway, Nucleus, Transcription, Transcription regulation, signaling protein, TRANSCRIPTION INHIBITOR-TRANSCRIPTION COMPLEX
Deposited on 2007-12-27, released 2008-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Suppressor of cytokine signaling 3
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O35718 (0-End)
• Chain 'B':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-117)
  Domains in SCOPe 2.06: d2jz3b_
• Chain 'C':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83940 (0-95)
  Domains in SCOPe 2.06: d2jz3c_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jz3B (B:)
  mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
  gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jz3C (C:)
  myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
  ftykvrytnssteipefpiapeialellmaanfldc