PDB entry 2jxy

View 2jxy on RCSB PDB site
Description: Solution structure of the hemopexin-like domain of MMP12
Class: hydrolase
Keywords: b-sheet hydrophobic core, Calcium, Extracellular matrix, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen
Deposited on 2007-12-01, released 2008-05-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (1-193)
    • expression tag (0)
  Domains in SCOPe 2.04: d2jxya_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jxyA (A:)
  mepalcdpnlsfdavttvgnkifffkdrffwlkvserpktsvnlisslwptlpsgieaay
  eiearnqvflfkddkywlisnlrpepnypksihsfgfpnfvkkidaavfnprfyrtyffv
  dnqywryderrqmmdpgypklitknfqgigpkidavfysknkyyyffqgsnqfeydfllq
  ritktlksnswfgc