PDB entry 2jxh

View 2jxh on RCSB PDB site
Description: Solution Structure of DNA binding domain of Proline Utilization A (PutA) for Psuedomonas putida
Class: DNA binding protein
Keywords: PutA, Proline, Utilization, DNA, binding, DNA BINDING PROTEIN
Deposited on 2007-11-19, released 2008-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jxha_
  • Chain 'B':
    Compound: proline dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jxhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jxhA (A:)
    matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jxhB (B:)
    matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle